DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG2574

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:274 Identity:54/274 - (19%)
Similarity:93/274 - (33%) Gaps:75/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1029 EAVSQEAELANDGATECNTMAEDEAMEEPLNLNALSESLPAIDQTGPMACSSPSWSIIPDTPSVD 1093
            :.|:.:.|:    .||....||.|...||..|:..|.:                       .||:
  Fly     4 DQVNSQTEM----ETEARARAEVEVEVEPEVLSRASVA-----------------------SSVE 41

  Fly  1094 ENCFQVLPNAPAAHNFISNLITPANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMV 1158
            |       .||:..:..|...|.|........::.|...::.:.|.......:...:...:..:.
  Fly    42 E-------TAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVN 99

  Fly  1159 GPKRTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVW 1223
            ||..:.|:...|..|.:|...||...|   .|.:.|...:.|:...|.:|:.:||       |.|
  Fly   100 GPVGSVYEGGHFRLDIRFPASYPFRAP---RIRFTTRIYHCNVDSRGAICLDVLG-------ERW 154

  Fly  1224 SPSSTMLQVLVSIQGLI------------LVDEPYYNEAGYEK-------------------QRG 1257
            ||...:.:||:||..|:            :.|:...|...::|                   ::.
  Fly   155 SPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFAMTKAQDKNREKD 219

  Fly  1258 TQLGNENSRVYNEM 1271
            ...|||.::..|.|
  Fly   220 ADQGNEQNQEENPM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 35/177 (20%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 30/151 (20%)
UQ_con 66..203 CDD:278603 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.