DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and UBE2T

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_054895.1 Gene:UBE2T / 29089 HGNCID:25009 Length:197 Species:Homo sapiens


Alignment Length:185 Identity:52/185 - (28%)
Similarity:84/185 - (45%) Gaps:20/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1123 QRA--VQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPP 1185
            |||  ::||..||.:..|.|:.....:|:||.:...::|...|||:..:|..:......||..||
Human     2 QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPP 66

  Fly  1186 VCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEPYYNEA 1250
               .|.:.|...:||:...||:|:.:|..   .....|.||..:..||.|||  :|:.||..:: 
Human    67 ---QIRFLTPIYHPNIDSAGRICLDVLKL---PPKGAWRPSLNIATVLTSIQ--LLMSEPNPDD- 122

  Fly  1251 GYEKQRGTQLGNENSRV-YNEMAIIKIA-QSTVKQLTNPPLIFRNELIEHFKEFG 1303
                   ..:.:.:|.. ||:.|.:|.| |.|.|...........|::::..|.|
Human   123 -------PLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 40/146 (27%)
UBE2TNP_054895.1 UBCc 5..147 CDD:238117 44/157 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..197 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.