DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and Ube2i

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_037182.1 Gene:Ube2i / 25573 RGDID:3926 Length:158 Species:Rattus norvegicus


Alignment Length:156 Identity:44/156 - (28%)
Similarity:74/156 - (47%) Gaps:38/156 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1120 AQYQRAVQRE----YLMLKSSLPNGVVVRAYEDRMDLMS--VMMVGPKRTPYQNALFFFDFQFGR 1178
            ||.::|.:::    ::.:.:..|:|.        |:||:  ..:.|.|.||::..||.....|..
  Rat    10 AQERKAWRKDHPFGFVAVPTKNPDGT--------MNLMNWECAIPGKKGTPWEGGLFKLRMLFKD 66

  Fly  1179 DYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVD 1243
            |||.|||.|   .:.....:||:|..|.||:|:|     .:::.|.|:.|:.|:|:.||.|:  :
  Rat    67 DYPSSPPKC---KFEPPLFHPNVYPSGTVCLSIL-----EEDKDWRPAITIKQILLGIQELL--N 121

  Fly  1244 EP--------------YYNEAGYEKQ 1255
            ||              ..|...|||:
  Rat   122 EPNIQDPAQAEAYTIYCQNRVEYEKR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 41/150 (27%)
Ube2iNP_037182.1 UQ_con 8..152 CDD:395127 44/156 (28%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.