DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and AT1G53023

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001185206.1 Gene:AT1G53023 / 10723074 AraportID:AT1G53023 Length:316 Species:Arabidopsis thaliana


Alignment Length:188 Identity:83/188 - (44%)
Similarity:114/188 - (60%) Gaps:22/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1116 PANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDY 1180
            |.|   :.:.:|:|:.:|..:||..:.|||.|.|:||:..:::|.:.|||.:.|||||.||...|
plant    55 PKN---WVKDIQKEWKILDKNLPETIFVRACESRIDLLRAVIIGAEGTPYHDGLFFFDIQFPDTY 116

  Fly  1181 PKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSP-SSTMLQVLVSIQGLILVDE 1244
            |..||..||.|... |:|||||:.|:||:||:.||.|:..|.|.| .|||||:|||||.|||.::
plant   117 PSVPPKVHYHSGGL-RINPNLYKCGKVCLSLISTWTGKKREKWLPKESTMLQLLVSIQALILNEK 180

  Fly  1245 PYYNEAGYEKQRGTQLGNENSRVYNEMAIIKIAQSTVKQLTNPPLIFRNELIEHFKEF 1302
            |||||.||||..||.||...|:.|:|...:    .::|.:             ||:||
plant   181 PYYNEPGYEKSMGTPLGESYSKDYSENVFV----FSLKTM-------------HFEEF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 76/146 (52%)
AT1G53023NP_001185206.1 UBCc 59..186 CDD:238117 64/127 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 163 1.000 Domainoid score I1236
eggNOG 1 0.900 - - E2759_KOG0895
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D808738at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2847
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1047
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.