DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and LOC101886876

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:XP_005171822.2 Gene:LOC101886876 / 101886876 -ID:- Length:194 Species:Danio rerio


Alignment Length:186 Identity:47/186 - (25%)
Similarity:79/186 - (42%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 DTWIGTIIDINECAVLKSSNGARVEITSNDFHKFKDA---VSECDRTVFNPNVFFPGNIVIGRMP 275
            |.|:|.:.|::...|:|.|||||..::..|..|..|.   :|:......:...|:||.::||   
Zfish    20 DFWLGKVYDLSIQIVVKLSNGARCSMSEEDGAKLYDIYPHISDVGLFFDDAYGFYPGQVLIG--- 81

  Fly   276 PPDRV-------KNLTPEITHPLTRKGRAVYTVESVETTSINVDWSCRAIGNATGSDDTDSDPLK 333
             |.:|       ..:.|    .|::|.:....||.|:...:.|.|..::.      ....||.:.
Zfish    82 -PAKVFANVQWLYGVKP----VLSKKSKFRVVVEEVQVVELKVTWITKSY------SPKGSDSVF 135

  Fly   334 EPRSLIKGEELHKVKRLSLYESYELQIHDRFYLKYSKCDLLVKYADWENEQAEKYI 389
            .|.|.|..|.|.:..:||.::...|.|   :|     |.|.:|  ...|::...|:
Zfish   136 PPPSTITQENLSRCNQLSTWQCIILDI---YY-----CLLWMK--KLRNKRVTNYL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603
LOC101886876XP_005171822.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D38527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.