DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and ube2d4

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:XP_012814892.1 Gene:ube2d4 / 100497147 XenbaseID:XB-GENE-962537 Length:159 Species:Xenopus tropicalis


Alignment Length:163 Identity:39/163 - (23%)
Similarity:70/163 - (42%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1132 MLKSSLPNGVVVRAYEDRMDLM-------------------SVMMVGPKRTPYQNALFFFDFQFG 1177
            ::.||.|..:......:.|||.                   ...::||..:|:|..:||....|.
 Frog     5 IILSSFPTFINYSLSVELMDLQRDPPAQCSAGPVGEDLFHWQATIMGPNDSPFQGGVFFLTIHFP 69

  Fly  1178 RDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLIL- 1241
            .|||..||   .:::.|...:||:...|.:|:.:|       ...|||:.|:.:||:||..|:. 
 Frog    70 TDYPFKPP---KVAFTTKIYHPNINSNGSICLDIL-------RSQWSPALTVSKVLLSICSLLCD 124

  Fly  1242 --VDEPYYNEAGY----EKQRGTQLGNENSRVY 1268
              .|:|...|..:    ::::..:|..|.::.|
 Frog   125 PNPDDPLVPEIAHTYKADREKYNRLAREWTQKY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 39/163 (24%)
ube2d4XP_012814892.1 COG5078 21..159 CDD:227410 36/147 (24%)
UBCc 21..158 CDD:294101 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.