DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG18754

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:403 Identity:142/403 - (35%)
Similarity:195/403 - (48%) Gaps:68/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STERNFLLLSLVVSALSGLVHRSDAAEISFGSCTPQQSDERGQCVHITSCPYLANLLMVEPKTPA 67
            |..|...:|.|    |..:.....|..:...||   |.||:  |..:.||..|.|:|.....|.|
  Fly     2 SDRRKVYILVL----LQAIFFNQLAECVRLSSC---QKDEK--CTRLVSCSPLMNILRPRGMTQA 57

  Fly    68 QRILLSKSQCGLDNRVEGLVNRILVCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGF--- 129
            ::.:.:..|||||.....|::.:.||||                    :.|||||....||.   
  Fly    58 EKDVFAHRQCGLDPNGHELLHMVYVCCP--------------------ELGDVLPNKQTCGQTTP 102

  Fly   130 LFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAV 194
            :|.||  |..|..|.|:||||||.|:...|          |:  ||||||.||:....|.::..|
  Fly   103 VFRDR--GAENAELNEYPWMVLLLYENRLS----------LI--RYVLTAAHCVIGGYLTQNDLV 153

  Fly   195 LHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIV 259
            |.||||||..|    ||.|   .:..|  .|:|:||.:..:|:.:..:....||||||:||:..|
  Fly   154 LKSVRLGESTT----DCIT---SESRC--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209

  Fly   260 SYTDYVRPICLPTDGLVQNNF--VDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSF 322
            .||..::|||     |:...|  .|..:.::||..|::.|   ..:..||...|...|..:|.||
  Fly   210 RYTKKIQPIC-----LLDAEFPLQDLNLQISGWDPTKSSQ---TLITSTVKERNPADCLNRYPSF 266

  Fly   323 KVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRT 387
            :   ..||:|||||...|||.|.||.|:|..:.:|..:..::||:.|||.:.|...|.|||||:.
  Fly   267 R---SASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKI 328

  Fly   388 GAFIDWIKQKLEP 400
            |.|.:|||..|.|
  Fly   329 GHFSEWIKANLAP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 16/51 (31%)
Tryp_SPc 135..397 CDD:238113 101/263 (38%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 15/50 (30%)
Tryp_SPc 108..338 CDD:238113 101/261 (39%)
Tryp_SPc 108..335 CDD:214473 98/258 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.