DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG34171

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:234 Identity:55/234 - (23%)
Similarity:89/234 - (38%) Gaps:59/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICA-------P 223
            |.|.:|.:|:|||:.||:.    ||:|.::...|:                ...:||       .
  Fly    57 CTGVILTNRHVLTSAHCIT----DKNGVMMSPKRI----------------VVALCASLFKTPES 101

  Fly   224 KHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYT-DYVRPICLPTDGLVQNNFVD----- 282
            :...:::...|||..|..|   |.||||:::|||.|... .::.|:.|....|...|...     
  Fly   102 EEFVVDIHNMIIHPYYHRN---QHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGI 163

  Fly   283 YGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFK-----------VKLDDSQMCA--- 333
            :|:....:|...:|      |.:.|.:.....|.:...|..           ||..:.|||.   
  Fly   164 FGVRRQRFGSFHSM------LLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDF 222

  Fly   334 GGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGT 372
            ||.|   .|.|...|..:..|:....|..:.:.|:.|.:
  Fly   223 GGPL---FCDGQLYGIALGSINCSSPDPVFFSDVSFYNS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 55/234 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 55/234 (24%)
Tryp_SPc 38..263 CDD:304450 55/234 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.