DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and f10

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:298 Identity:85/298 - (28%)
Similarity:141/298 - (47%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LQQGDVLPGNDVCGFLFAD------RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNS 173
            :.|...||..:|.|....:      ||.||...:..|.||..||    :..|...| |||.:|:.
 Frog   202 MNQTGTLPERNVTGINILNPNDPNVRIVGGRECSQGECPWQALL----VSDEDEGF-CGGTILSR 261

  Fly   174 RYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEM 238
            .::|||.||:...:..|       |.:||.:|:.. :.|..::            :|||.|:|..
 Frog   262 EFILTAAHCMNQTKYFK-------VVVGELNTKIS-EGTESIH------------KVEKIIMHPR 306

  Fly   239 YAPNSVDQRNDIALVRLKRIVSYTDYVRPICLP----TDGLVQNNFVDYGMDVAGWGL--TENMQ 297
            :..::.|.  |||:::||..:::|:.:.|.|:|    .|.::.|   :....|:|:|.  ....|
 Frog   307 FVKSTYDY--DIAVIKLKEAINFTENIIPACIPDPEFADQVLMN---EPDAMVSGFGRIHERGRQ 366

  Fly   298 PSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGV-DTCGGDSGGPLMVPISTGGRDV 361
            .|.::: :.|......||:|. |:|.:  .::..|||....| |.|.||||||.:.|.    :..
 Frog   367 ASTLQM-LQVPYIKRHSCKES-STFAI--TENMFCAGFDTEVKDACQGDSGGPHVTPF----KGT 423

  Fly   362 FYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKLE 399
            :::.|:.|:| :.|..||..||||:......|:|..|:
 Frog   424 YFVTGIVSWG-EGCARKGKFGVYTKVSKLHRWLKGVLK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 78/268 (29%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 77/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.