DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG9733

DIOPT Version :10

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:32 Identity:10/32 - (31%)
Similarity:16/32 - (50%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 FEKANQGV---KQALETAQTNNRWSKVNIDKM 934
            :|..|.||   |.|.||:..:.|..:..:.|:
  Fly    30 YENDNIGVDGYKFAFETSDGHQRQEQAELKKL 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 36..94 CDD:463440
Tryp_SPc 135..397 CDD:238113
CG9733NP_651784.2 CLIP 25..78 CDD:463440 10/32 (31%)
Tryp_SPc 162..415 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.