DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:290 Identity:83/290 - (28%)
Similarity:127/290 - (43%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALL 171
            |.|:     |:....|..|:.|     ||..|......:.|::|.|    |||....:.|||:::
  Fly    18 PAPA-----QKLTPTPIKDIQG-----RITNGYPAYEGKVPYIVGL----LFSGNGNWWCGGSII 68

  Fly   172 NSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIH 236
            .:.:||||.||       .:||...::..|. ..||.|..|..:....|             |.|
  Fly    69 GNTWVLTAAHC-------TNGASGVTINYGA-SIRTQPQYTHWVGSGDI-------------IQH 112

  Fly   237 EMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAI 301
            ..|  ||.:..|||:|:|... |.:...|..:.||:......::..:....:|||.|.:..|...
  Fly   113 HHY--NSGNLHNDISLIRTPH-VDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPD 174

  Fly   302 KLK-ITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIA 365
            .|: :.|.:.:.:.|...:|     |.|:.:|.....|..||||||||||:.  ..|.|    :.
  Fly   175 WLQSVDVQIISQSDCSRTWS-----LHDNMICINTDGGKSTCGGDSGGPLVT--HDGNR----LV 228

  Fly   366 GVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395
            ||||:|:......|.|.|::|...::|||:
  Fly   229 GVTSFGSAAGCQSGAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 76/262 (29%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.