DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG4815

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:105/278 - (37%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 FADRIFGGTNTTLWEF--PWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGA 193
            |..||:.|..||:...  ..:.|...:||.       |...||..|::|||.||..:....|...
  Fly    31 FHPRIYNGIKTTVESLGGVGIQLFNGRKLV-------CSATLLTPRHILTAAHCFENLNRSKFHV 88

  Fly   194 VLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLK-- 256
            :........|            :|......|.|.::     ||..||  .:....|:|:.:.|  
  Fly    89 IGGKSAEFTW------------HGNNFNKNKLIRVQ-----IHPKYA--KMKFIADVAVAKTKYP 134

  Fly   257 ---RIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIK---LKITVNVWNLTSC 315
               :.:.|....|.:..|.|.|:          .||||....:...:.|   ..:.|.:.:...|
  Fly   135 LRSKYIGYAQLCRSVLHPRDKLI----------AAGWGFEGGVWDESRKKTFRSMKVGIVSKRDC 189

  Fly   316 QEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGW 380
            :::...   |:..:.:|||.......|.|||||||::     ||.|   .|:.:: |..||....
  Fly   190 EKQLDR---KMPPNIICAGAYNNKTLCFGDSGGPLLL-----GRQV---CGINTW-TFKCGNNEK 242

  Fly   381 PGVYTRTGAFIDWIKQKL 398
            |.||.....:..:||:.:
  Fly   243 PDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 64/271 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 60/257 (23%)
Trypsin 49..256 CDD:278516 58/254 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.