DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG16710

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:374 Identity:137/374 - (36%)
Similarity:195/374 - (52%) Gaps:41/374 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AEISFGSCTPQQSDERGQCVHITSCPYLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNRILV 92
            ||..:..|   ..||:  |:.:..|..|...|.....|||::.:.....||...:.:.|::|:|:
  Fly    23 AESEYPPC---NLDEK--CISLARCTSLLPFLKPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLI 82

  Fly    93 CCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCG-FLFADRIFGGTNTTLWEFPWMVLLQY-- 154
            |||                    ..|.:||...:|| .:.|.|||||..|...|.|||.|:.|  
  Fly    83 CCP--------------------NMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAH 127

  Fly   155 --KKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNG 217
              :.:::|.....|.|:|:.:||||||.|||....||     |..|||||.:..::|||.|.:||
  Fly   128 RSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLD-----LRRVRLGEHNILSNPDCVTHING 187

  Fly   218 QRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQN-NFV 281
            :..|||:|::|:|:..|.|..|........|||||:|||..|.||..::|||:..|.:..| :|.
  Fly   188 REHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFS 252

  Fly   282 DYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLD-DSQMCAGGQLGVDTCGGD 345
            ::.:.:|||||:.....|.:.|:..||..|...|  ..|...:.|| ::.:|||...|.|||.||
  Fly   253 NHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADEC--SLSEPSLGLDKETHICAGNLGGNDTCKGD 315

  Fly   346 SGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWI 394
            ||||||..:..|..:..|:||:||||...||.  .|..||:|..|::||
  Fly   316 SGGPLMAIMERGDEEFVYLAGITSYGYSQCGY--GPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 13/51 (25%)
Tryp_SPc 135..397 CDD:238113 110/266 (41%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 12/50 (24%)
Tryp_SPc 105..362 CDD:214473 109/265 (41%)
Tryp_SPc 106..362 CDD:238113 108/264 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463219
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.