DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG31199

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:103/282 - (36%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NDVCGFLFADRIFGGTNTTL--WEFPWMVLLQYKKLFSETYTFN-CGGALLNSRYVLTAGHCLAS 185
            :|.||....|::....:|..  .|..|:..:.|.|.|......| |.|.|::.|.||...||.  
  Fly    26 DDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCF-- 88

  Fly   186 RELDKSG-AVLHSVRLGEWDTRTDPDCTTQMNGQRIC-------APKHIDIEVEKGIIHEMYAPN 242
              :..:| |...||.||. ..::.|      .|.|:|       .|.. :|::.:..||..|  :
  Fly    89 --VQYNGVAEAFSVHLGV-HNKSAP------VGVRVCETDGYCVRPSQ-EIKLAEIAIHPDY--D 141

  Fly   243 SVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITV 307
            |...:|.:|::.|:|.......|.|||:|...|:....|.....|||..:.|:     .:||..|
  Fly   142 SRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFED-----FRLKTWV 201

  Fly   308 NVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGT 372
            |..:...||.|..:.....:            ..||...            :.|.|..|....|.
  Fly   202 NTLSRGFCQSKVKTLVTSSN------------TVCGYHK------------QPVAYYLGAPLVGL 242

  Fly   373 KPCGLKGW-PGVYTRTGAFIDW 393
            :.   ||. ...|...|..|||
  Fly   243 QK---KGHVTQNYYLVGIMIDW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 66/271 (24%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 61/257 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.