DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG5255

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:267 Identity:70/267 - (26%)
Similarity:114/267 - (42%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHS 197
            :||.||........|:.:.||  .:.|..:  :||||:::.|:::||.||...|:     |....
  Fly    28 NRIVGGEEAAAGLAPYQISLQ--GIGSGAH--SCGGAIIDERWIITAAHCTRGRQ-----ATAFR 83

  Fly   198 VRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYT 262
            |..|..|        ...||.:...|..|       :.|..|||..  .||||||:.|...:.:.
  Fly    84 VLTGTQD--------LHQNGSKYYYPDRI-------VEHSNYAPRK--YRNDIALLHLNESIVFD 131

  Fly   263 DYVRPICLPTDGLVQNNFVDYGMDVAGWG-LTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKL 326
            :..:|:.|..:.||..:    .:.:.||| |:......|....:.||......|:..:.: ..::
  Fly   132 NATQPVELDHEALVPGS----RLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDN-STRV 191

  Fly   327 DDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFI 391
            |...:|.....|...|.|||||||:    ..|:    :..:.::|. ||. ||:|..:.....:.
  Fly   192 DIGHVCTFNDKGRGACHGDSGGPLV----HNGK----LVALVNWGL-PCA-KGYPDAHASISYYH 246

  Fly   392 DWIKQKL 398
            |:|:..|
  Fly   247 DFIRTHL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 68/262 (26%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/260 (26%)
Tryp_SPc 30..252 CDD:238113 68/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.