DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG5246

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:278 Identity:71/278 - (25%)
Similarity:119/278 - (42%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198
            |:.||.::.....|:.|.:.  ..|.|..   |||:::..:::|||.||:               
  Fly    41 RVIGGVDSPTGFAPYQVSIM--NTFGEHV---CGGSIIAPQWILTAAHCM--------------- 85

  Fly   199 RLGEWDTR-----------TDPDCTTQMNGQRI-CAPKHIDIEVEKGIIHEMYAPNSVDQRNDIA 251
               ||..:           |.|.....::|.:| |:  |     :|...|           ||||
  Fly    86 ---EWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCS--H-----DKPAYH-----------NDIA 129

  Fly   252 LVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKL-KITVNVWNLTSC 315
            |:...:.:.|.|..:||.|.:.|.:..  |...:.:.|||.|:.....:.:| ||.:|..:..:|
  Fly   130 LIHTAKPIVYDDLTQPIKLASKGSLPK--VGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNC 192

  Fly   316 QEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGW 380
            |.:..:.. .|.:..:|...|.|..:|.|||||||:....|       :.||.::| :.|.: |:
  Fly   193 QSRVRNAN-WLSEGHVCTFTQEGEGSCHGDSGGPLVDANQT-------LVGVVNWG-EACAI-GY 247

  Fly   381 PGVYTRTGAFIDWIKQKL 398
            |.|:.....:.|||:|.:
  Fly   248 PDVFGSVAYYHDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 69/274 (25%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/272 (25%)
Tryp_SPc 42..263 CDD:238113 69/273 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.