DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG4053

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:126/277 - (45%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LFADRIFGGTNTTLWEFPWMVLLQ--YKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSG 192
            |..:||.||........|:.|.:|  :|       |..|.|.:||.:::||||||    .||.| 
  Fly    30 LLDNRIVGGQEAEDGVAPYQVSIQTIWK-------THICSGVILNEQWILTAGHC----ALDFS- 82

  Fly   193 AVLHSVRL--GEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRL 255
              :..:|:  |..| |.:|       ||.:..        ::.::|.:|....| ..|||||:.:
  Fly    83 --IEDLRIIVGTND-RLEP-------GQTLFP--------DEALVHCLYDIPYV-YNNDIALIHV 128

  Fly   256 KRIVSYTDYVRPICL----PTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLT--S 314
            ...:.:.|..:.:.|    |..|..        :.:.|||..|:..|:...|: |:|:..:.  .
  Fly   129 NESIIFNDRTQIVELSREQPPAGST--------VTLTGWGAPESSYPTVQYLQ-TLNLTIIAHEE 184

  Fly   315 CQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKG 379
            |:|:: .|...:|...:|...:.|...|.||||||||    ..|:    :.|:.::| :.||: |
  Fly   185 CRERW-DFHDGIDIGHICTFTREGEGACSGDSGGPLM----WEGK----LVGLVNWG-RACGV-G 238

  Fly   380 WPGVYTRTGAFIDWIKQ 396
            .|.:|..|..:.|||::
  Fly   239 MPDMYANTVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 75/272 (28%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 74/269 (28%)
Tryp_SPc 35..256 CDD:238113 75/272 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.