DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and snk

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:394 Identity:107/394 - (27%)
Similarity:161/394 - (40%) Gaps:115/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QCVHITSCPYLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNRILVCCP-------------- 95
            ||:|:          :.|.:....||.:    |...|.|.      ::|||              
  Fly   109 QCLHV----------IREYRVHGTRIDI----CTHRNNVP------VICCPLADKHVLAQRISAT 153

  Fly    96 -------QSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLL- 152
                   .:.|.::.|:..|.|.:..:..              ...|.|||.|....||.|..| 
  Fly   154 KCQEYNAAARRLHLTDTGRTFSGKQCVPS--------------VPLIVGGTPTRHGLFPHMAALG 204

  Fly   153 --QYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQM 215
              |......:...:.|||||::..|||||.||..|......     .||||.  .:.:....||.
  Fly   205 WTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPD-----MVRLGA--RQLNETSATQQ 262

  Fly   216 NGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICL--------PT 272
                       ||::...::|..|  .|....:||||::|.|.|.:::.|||.||        ||
  Fly   263 -----------DIKILIIVLHPKY--RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPT 314

  Fly   273 DGLVQNNFVDYGMDVAGWGLTENMQPSAIKLK-ITVNVWNLTSCQEKYSSFKVKLD----DSQMC 332
                        :..||||.||.:...:..|: :.::|....:|::.|...: :|.    :.|.|
  Fly   315 ------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKER-RLPRGIIEGQFC 366

  Fly   333 AG---GQLGVDTCGGDSGGPL--MVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFID 392
            ||   |  |.|||.||||||:  ::|   ....|.::.|:||:| |.|.....||||||..:::|
  Fly   367 AGYLPG--GRDTCQGDSGGPIHALLP---EYNCVAFVVGITSFG-KFCAAPNAPGVYTRLYSYLD 425

  Fly   393 WIKQ 396
            ||::
  Fly   426 WIEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 9/48 (19%)
Tryp_SPc 135..397 CDD:238113 91/283 (32%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 10/49 (20%)
Tryp_SPc 186..430 CDD:238113 91/283 (32%)
Tryp_SPc 186..427 CDD:214473 89/279 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.