DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG13318

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:383 Identity:106/383 - (27%)
Similarity:153/383 - (39%) Gaps:100/383 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QCVHITSCPYLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNR------------------IL 91
            |||...||   ||.|...|...:.:|         |.|:   ||.                  ::
  Fly    92 QCVPPGSC---ANPLPTAPSDGSGQI---------DIRI---VNNGGYPTVPTTSSTLTCSYGLV 141

  Fly    92 VCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKK 156
            .||............|.|.:..|      .||         ...||.       :||..     .
  Fly   142 ACCQAGSYQCGRRFPPPPGSTTA------APG---------QASFGA-------YPWQA-----A 179

  Fly   157 LFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRIC 221
            |.:....:..||||:.:::||||.|     ::...|.....|||||||..:        ..:.|.
  Fly   180 LLTTADVYLGGGALITAQHVLTAAH-----KVYNLGLTYFKVRLGEWDAAS--------TSEPIP 231

  Fly   222 APKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYT--DYVRPICLPTDGLVQNNFVDYG 284
            |.   |:.:....::..:.||::  :||:|:::|...||.|  ..|..:||||     .:||...
  Fly   232 AQ---DVYISNVYVNPSFNPNNL--QNDVAILKLSTPVSLTSKSTVGTVCLPT-----TSFVGQR 286

  Fly   285 MDVAGWGLTE---NMQPSAIKLKITVNVWNLTSCQEKY------SSFKVKLDDSQMCAGGQLGVD 340
            ..|||||..:   .....||:.::.|.:....:||...      ||| |....|.:||||:.|.|
  Fly   287 CWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSF-VLSPTSFICAGGEAGKD 350

  Fly   341 TCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398
            .|.||.|.|| |..|.|   |:|:.|:.::|. .|...|.||||...|.::.||:..|
  Fly   351 ACTGDGGSPL-VCTSNG---VWYVVGLVAWGI-GCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 14/66 (21%)
Tryp_SPc 135..397 CDD:238113 84/272 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 84/273 (31%)
Tryp_SPc 169..399 CDD:214473 82/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.