DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG7542

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:121/269 - (44%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVR 199
            |..|....:.:||:...|...  |....|: |||.|::..:::||.||:       .||...:|.
  Fly    27 ITNGEPAEVGQFPYQAGLNVS--FGNWSTW-CGGTLISHYWIITAAHCM-------DGAESVTVY 81

  Fly   200 LGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKG--IIHEMYAPNSVDQRNDIALVRLKRIVSYT 262
            ||..:...:.:     .||.       .|.|||.  |:|..|..::|  .|||:|:||...|.:|
  Fly    82 LGAINIGDESE-----EGQE-------RIMVEKSGIIVHSNYMASTV--VNDISLIRLPAFVGFT 132

  Fly   263 DYVRPICLPTDGLVQNNFVDY---GMDVAGWG----LTENMQPSAIKLKITVNVWNLTSCQEKYS 320
            |.:|...||.  .:...|..|   ....:|||    .::::.|....:::.:...:|  |:..:|
  Fly   133 DRIRAASLPR--RLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSL--CRMYWS 193

  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385
            .   .:.:..:|.....|..||.|||||||:.......    |:.|.||:||......|:|.|:|
  Fly   194 G---AVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSS----YLIGSTSFGTSMGCQVGFPAVFT 251

  Fly   386 RTGAFIDWI 394
            |..:::|||
  Fly   252 RISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 76/269 (28%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 76/269 (28%)
Tryp_SPc 27..260 CDD:214473 74/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.