DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon74E

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:285 Identity:93/285 - (32%)
Similarity:133/285 - (46%) Gaps:40/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTA 179
            |.||..:...|: |.....||.||......:||:.|.|..::. ::.|.: ||.:|::.||:|||
  Fly    13 LVQGRSISCLDM-GHGIGGRIAGGELARANQFPYQVGLSIEEP-NDMYCW-CGASLISDRYLLTA 74

  Fly   180 GHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSV 244
            .||     ::|:.|:                 |..:.|....||:.: |......:|.....|..
  Fly    75 AHC-----VEKAVAI-----------------TYYLGGVLRLAPRQL-IRSTNPEVHLHPDWNCQ 116

  Fly   245 DQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQN-NFVDYGMDVA-GWGLTENMQPSAI--KLKI 305
            ...||||||||.......|.:|||.||  ||..: |..||...:| ||| ..|.:.:||  .|:.
  Fly   117 SLENDIALVRLPEDALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWG-RMNDESTAISDNLRY 178

  Fly   306 TVN-VWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTS 369
            ... |.:...|:..|::.|    .:.:|.....|..||.|||||||:........|:  :.||||
  Fly   179 VYRFVESNEDCEYSYANIK----PTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADI--LIGVTS 237

  Fly   370 YGTKPCGLKGWPGVYTRTGAFIDWI 394
            ||.|....||:|.|:||..|::|||
  Fly   238 YGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 87/265 (33%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 86/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.