DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG18180

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:65/276 - (23%)
Similarity:106/276 - (38%) Gaps:63/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCG----GALLNSRYVLTAGHCLASRELD----- 189
            ||..|......:.|::|     .||..|...|.|    |.::.:.::|||.|||....::     
  Fly    35 RIVNGYPAPEGKAPYIV-----GLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGS 94

  Fly   190 ---KSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIA 251
               .:||...:||...:.:.  ||..:|  |.|                             ||.
  Fly    95 NWGWNGAYRQTVRRDNFISH--PDWPSQ--GGR-----------------------------DIG 126

  Fly   252 LVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQ 316
            |:|... |.:...:..|.||:.....:.:.|......|||..:|...:.....:.|.:.:.:.|:
  Fly   127 LIRTPH-VDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECE 190

  Fly   317 EKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWP 381
            :.|.|    :..:.||.....|...|||||||||:.      .|...:.||.::.:..|  ...|
  Fly   191 QAYGS----VASTDMCTRHADGKSVCGGDSGGPLVT------HDNARLVGVITFASVSC--HDGP 243

  Fly   382 GVYTRTGAFIDWIKQK 397
            ..|||...:::||:.:
  Fly   244 SGYTRVSDYLEWIRDQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 64/273 (23%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 63/271 (23%)
Tryp_SPc 36..259 CDD:238113 64/273 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.