DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and sphinx2

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:103/268 - (38%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198
            ||.||.....:...::|.:.|.|....:..|. .|.:::::::||....|..:.::   |...|.
  Fly    25 RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILTVKEVLIFKYIE---AHFGSK 85

  Fly   199 RLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTD 263
            | ..|             |..|     :.|..|....|       .|:...||||:    ..|..
  Fly    86 R-AFW-------------GYDI-----LRIYRENFYFH-------YDKTRIIALVK----CPYQK 120

  Fly   264 YVR---PICLPTDGLVQNNFVDYGMDVAGWGLTENMQ---PSAIKLKITVNVWNLTSCQEKYSSF 322
            :.|   .:.:|..|.....:|.....|.||| |:..:   |:.::. :.|.|.|.|.|.:.::..
  Fly   121 FDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTWMRC-VEVEVMNNTECAKYHTPL 183

  Fly   323 KVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRT 387
            |.    .:||..|:.....|.||.||.:   ::.|....|  .|:.......|.: |:|.|:.|.
  Fly   184 KW----YEMCTSGEGFKGVCEGDMGGAV---VTMGPNPTF--IGIIWLMPTNCSI-GYPSVHIRV 238

  Fly   388 GAFIDWIK 395
            ...|.|||
  Fly   239 SDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 62/267 (23%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 60/265 (23%)
Tryp_SPc 26..248 CDD:304450 62/267 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.