DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG6592

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:334 Identity:90/334 - (26%)
Similarity:153/334 - (45%) Gaps:53/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SQCGLDNR-VEGL-VNRILVCCPQ--SMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRI 135
            |...:||| ::|| :.|.:....:  .....:::.|.||.....|.:          |.:..|||
  Fly    69 SASNVDNRHIKGLGMGREMSALSEEDDREPLVLNLETTPLMEKMLPE----------GAMAMDRI 123

  Fly   136 FGGTNTTLWEFPWMV--LLQYKKLFSETYTFNCGGALLNSRYVLTAGHC--LASRELDKSGAVLH 196
            |||.......||:.|  |||..|     ..:.|||:|::.::|:||.||  :|.|.|        
  Fly   124 FGGDVGNPHCFPYQVGMLLQRPK-----GLYWCGGSLISDKHVITAAHCVDMAKRAL-------- 175

  Fly   197 SVRLGEWDTRTDPDCTTQMNGQ-RICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVS 260
             |.||..:.:     ..:..|| |:..|.      |...|:..:.|..:  ::|||:|||...||
  Fly   176 -VFLGANEIK-----NAKEKGQVRLMVPS------ENFQIYPTWNPKRL--KDDIAIVRLPHAVS 226

  Fly   261 YTDYVRPICLPTDGLVQNNFVDYGMDVAGWG--LTENMQPSAIKLKITVNVWNLTSCQEKYSSFK 323
            :.:.:.||.||.......:|.:.....:|||  .|.....|.:...:.:.:.:..:|:   |:|.
  Fly   227 FNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCK---SNFP 288

  Fly   324 VKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTG 388
            :....:.:|..|:....||.|||||||::......:.|  :.|:||:|:.....:|:|..:|:..
  Fly   289 LSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRV--LVGITSFGSIYGCDRGYPAAFTKVA 351

  Fly   389 AFIDWIKQK 397
            :::|||..:
  Fly   352 SYLDWISDE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 7/20 (35%)
Tryp_SPc 135..397 CDD:238113 76/268 (28%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/266 (28%)
Tryp_SPc 123..359 CDD:238113 76/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.