DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon65Aii

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:280 Identity:74/280 - (26%)
Similarity:113/280 - (40%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCL 183
            |:..||.:.|     ||..|......:.|::|.|::..  .....:.|||:::...:||||.||.
  Fly    26 DMPAGNKING-----RITNGYPAYEGKVPYIVALRFDN--GNGGGWYCGGSIIGHEWVLTAAHCT 83

  Fly   184 --ASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQ 246
              ||......|||        |  |..|..|            |.|    .|.:|          
  Fly    84 YGASYVTISYGAV--------W--RQQPQFT------------HYD----TGNLH---------- 112

  Fly   247 RNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLK-ITVNVW 310
             |||||:|... |.:...|..:.||......|||..:...::|||.:.:.......|. :.:.:.
  Fly   113 -NDIALIRTPH-VDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQIS 175

  Fly   311 NLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPC 375
            :.:.|.:.|.|..:  ..:.:|........:|.|||||||:  :..|.|.|    |:.|:|:...
  Fly   176 DNSVCLDYYGSHYI--TSNHLCYATPENKGSCSGDSGGPLV--LHDGNRQV----GIVSFGSAAG 232

  Fly   376 GLKGWPGVYTRTGAFIDWIK 395
            .|...|...||...::|||:
  Fly   233 CLSNSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 69/264 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 68/262 (26%)
Tryp_SPc 37..254 CDD:238113 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.