DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:264 Identity:73/264 - (27%)
Similarity:123/264 - (46%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198
            ||..|...|..:||:.|.|.:.   |.:.::.|||:::::.:||||.||       .|||...::
  Fly    39 RITNGKTATSGQFPYQVGLSFA---STSGSWWCGGSIIDNTWVLTAAHC-------TSGASAVTI 93

  Fly   199 RLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTD 263
            ..|         .|.:.:.|.:..     :..:..:.|..|  ||:..||||:|::.. .|::|.
  Fly    94 YYG---------ATVRTSAQLVQT-----VSADNFVQHASY--NSIVLRNDISLIKTP-TVAFTA 141

  Fly   264 YVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPS-AIKLKITV-NVWNLTSCQEKYSSFKVKL 326
            .:..:.||......:.:.......:|||.|.:...| |..|:..| .|.:::.||..|.|  :..
  Fly   142 LINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGS--LVA 204

  Fly   327 DDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFI 391
            .::.:|......|.||.|||||||::...:      .:.||||:.:......|.|..:||..:::
  Fly   205 TNNVICVATPNKVSTCNGDSGGPLVLVSDS------KLIGVTSFVSSAGCESGAPAGFTRVTSYL 263

  Fly   392 DWIK 395
            ||||
  Fly   264 DWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 72/263 (27%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 70/261 (27%)
Tryp_SPc 40..269 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.