DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:300 Identity:91/300 - (30%)
Similarity:137/300 - (45%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALL 171
            |.|..|...::..|:  .|:.|     ||.||:|..:.:||:.|.|..|  .|...:..|||:|:
  Fly    17 PEPELRHRSREMPVV--GDIGG-----RITGGSNAAVGQFPYQVGLSLK--LSALSSAWCGGSLI 72

  Fly   172 NSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIH 236
            .|.:||||.||       ..|....:|.||. ..||..:.|..::...|             |||
  Fly    73 GSTWVLTAAHC-------TDGVQSVTVYLGA-TVRTSAEITHTVSSSDI-------------IIH 116

  Fly   237 EMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA---GWGLTE---- 294
            ..:  ||.:.||||:|:::. ..|.:..:..:.||:   :.|::..:..|||   |||.|.    
  Fly   117 SGW--NSANLRNDISLIKIP-ATSSSSRISAVKLPS---ISNSYSTFVGDVAVASGWGRTSDTSS 175

  Fly   295 ----NMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPIS 355
                |:|  .:.|.:..|    |.|.:.|.:..|  .||.:|........||.|||||||::..|
  Fly   176 GVATNLQ--YVDLTVITN----TKCAQTYGTSVV--TDSTLCVATTDAKSTCNGDSGGPLVLKSS 232

  Fly   356 TGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395
            :..      .|:||:|......||:|..:||..:::||||
  Fly   233 SEQ------IGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 83/271 (31%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 82/270 (30%)
Tryp_SPc 38..268 CDD:238113 83/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.