DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG10477

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:325 Identity:83/325 - (25%)
Similarity:136/325 - (41%) Gaps:80/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ILVCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQY 154
            :||....::..:|:..:.....||:    ..:|..|       .||..|......:||:.|.|.:
  Fly     6 VLVLAIATVSADILRQDTPVHPRDS----SAVPSID-------GRITNGNKAAANQFPYQVGLSF 59

  Fly   155 KKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQR 219
            |   |...::.|||:::.:.:||||.||       ..||...::..|. ..||......:::.  
  Fly    60 K---SSAGSWWCGGSIIANTWVLTAAHC-------TKGASSVTIYYGS-TVRTSAKLKKKVSS-- 111

  Fly   220 ICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYG 284
                       .|.:.|..|  |:...||||:|::... |::|..:..|.||.   :.:::..|.
  Fly   112 -----------SKFVQHAGY--NAATLRNDISLIKTPS-VTFTVSINKIALPA---IASSYSTYA 159

  Fly   285 MDVA---GWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKV-------KLDDSQMCAGGQLGV 339
            ...|   |||.|     |...:.:..|:        :|:.|:|       |...|.:...|.:.|
  Fly   160 GQTAVASGWGRT-----SDSSIAVATNL--------QYAQFQVITNAVCQKTFGSSVVTSGVICV 211

  Fly   340 D------TCGGDSGGPLMVPISTGGRDVFYIAGVTSY-GTKPCGLKGWPGVYTRTGAFIDWIKQK 397
            :      ||.|||||||    :...|    :.||||: .:|.|. |..|..:||..:::||||.:
  Fly   212 ESINKKSTCQGDSGGPL----ALNNR----LIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIKNQ 267

  Fly   398  397
              Fly   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 2/3 (67%)
Tryp_SPc 135..397 CDD:238113 75/278 (27%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 73/276 (26%)
Tryp_SPc 40..267 CDD:238113 75/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.