DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG1299

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:380 Identity:122/380 - (32%)
Similarity:175/380 - (46%) Gaps:67/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQCVHITSCPYLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNRILVCCPQSMRGNIMDSEPT 108
            |.||.|..|..|.|.|....:.......|..|.....|:      ...||||...  .|.::.|.
  Fly   172 GNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNK------GTQVCCPTGQ--GITNTTPA 228

  Fly   109 PSTRDALQQGDVLPGN------------DVCGFL--FADRIFGGTNTTLWEFPWMVLLQYKKLFS 159
            ||        .::|.|            :.||..  :..:|.||..:....:||:.||.|..  .
  Fly   229 PS--------QIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDD--P 283

  Fly   160 ETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPK 224
            ....|.|||.|:.:|:||||.||:...        |..|||||.|..||.:            ..
  Fly   284 SGSPFKCGGTLITARHVLTAAHCIRQD--------LQFVRLGEHDLSTDTE------------TG 328

  Fly   225 HIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLP-TDGLVQNNFVDYGMDVA 288
            |:||.:.:.:.|..|  |..:.|:|:|::.|:|.|.:|..:.||||| |..|.|.::|.|...||
  Fly   329 HVDINIARYVSHPDY--NRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVA 391

  Fly   289 GWGLT-ENMQPSAIKLKITVNVWNLTSCQEKYSSFK-----VKLDDSQMCAG---GQLGVDTCGG 344
            |||.| |..:.:.:..::.:.:::...|.:.|:..|     .:.|.:.:|||   |  |.|||.|
  Fly   392 GWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSG--GKDTCQG 454

  Fly   345 DSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKLE 399
            |||||||:|....|:..||:.||.|||. .|.....||||:.|..|:|||.|:::
  Fly   455 DSGGPLMLPEPYQGQLRFYLIGVVSYGI-GCARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 12/49 (24%)
Tryp_SPc 135..397 CDD:238113 98/271 (36%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/49 (24%)
Tryp_SPc 260..503 CDD:214473 96/269 (36%)
Tryp_SPc 261..503 CDD:238113 96/268 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.