Sequence 1: | NP_651168.1 | Gene: | SPE / 42791 | FlyBaseID: | FBgn0039102 | Length: | 400 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611910.2 | Gene: | CG15873 / 37898 | FlyBaseID: | FBgn0035003 | Length: | 297 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 55/202 - (27%) |
---|---|---|---|
Similarity: | 86/202 - (42%) | Gaps: | 52/202 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 CGGALLNSRYVLTAGHCLASR---ELDKSGAVL---HSVRLGEWDTRTDPDCTTQMNGQRICAPK 224
Fly 225 HIDIEVEKGIIHEMYAPNSVDQRNDIALVRL-KRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA 288
Fly 289 ---GWGLTENMQP---SAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMC---AGGQLGVDTCGG 344
Fly 345 DSGGPLM 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SPE | NP_651168.1 | CLIP | 42..94 | CDD:314844 | |
Tryp_SPc | 135..397 | CDD:238113 | 55/202 (27%) | ||
CG15873 | NP_611910.2 | Tryp_SPc | 36..250 | CDD:214473 | 55/202 (27%) |
Tryp_SPc | 59..250 | CDD:238113 | 55/202 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45436722 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |