DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG30414

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:311 Identity:104/311 - (33%)
Similarity:155/311 - (49%) Gaps:54/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ALQQGDVLPG---NDVCGFL---FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLN 172
            ::|.|:..||   :..||..   |...|.||.:..|:..||||.:..:||        |||:|:.
  Fly    14 SIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGEKL--------CGGSLIT 70

  Fly   173 SRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTR-TDPDCT------------------TQMNGQ 218
            ||:||||.||:.|..:        .|||||:.|| ...||:                  |:..|:
  Fly    71 SRFVLTAAHCIVSTHM--------RVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127

  Fly   219 RICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDY 283
            ..|.||..::.|::.|:|..|   :::..|||.|:|:|..|.|:||||||||..:|.:..:.:  
  Fly   128 DCCVPKSYELAVDRKILHADY---NLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPI-- 187

  Fly   284 GMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGG 348
             .::.|||:|.:..||....:.||...:|..|:.|::.   ::|:||:||.| ...|.|.|||||
  Fly   188 -FNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTK---QVDESQICAAG-TNSDACHGDSGG 247

  Fly   349 PLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKLE 399
            ||...:...|..:.:..|:.|||:..|...   .|||......|||...:|
  Fly   248 PLSAQVPFAGSWLTFQYGLVSYGSAACHSF---SVYTNVTHHRDWIVNAIE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 96/280 (34%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 94/277 (34%)
Tryp_SPc 41..290 CDD:238113 94/277 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.