DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG13527

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:254 Identity:58/254 - (22%)
Similarity:104/254 - (40%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEW--DTRTDPDCTTQMNGQ 218
            |.|.:.:  .|||.||::::|:||.||:..:     ..:::..|   |  .....|.......|:
  Fly    54 KYFGDNH--YCGGGLLSNQWVITAAHCVMGQ-----SKIMYKAR---WLLVVAGSPHRLRYTPGK 108

  Fly   219 RICAPKHIDIEVEKGIIHEMYAPNSVDQRN--DIALVRLKRIVSYTDYVRPICLPTDGLV----Q 277
            .:|:|           :..:|.|.:....|  ::||::|:..:...|       |..|.:    :
  Fly   109 SVCSP-----------VSSLYVPKNFTMHNTFNMALMKLQEKMPSND-------PRIGFLHLPKE 155

  Fly   278 NNFVDYGMDVAGWGLTENMQPSAIKL-KITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQ---LG 338
            ...:.....|.|||......|.|:.: ::.|.:.:...|:..:..:    .|..||||..   :.
  Fly   156 APKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHY----GDGMMCAGNNNWTID 216

  Fly   339 VDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKP--CGLKGWPGVYTRTGAFIDWIK 395
            .:.|.||.|.||:     .|:   .:.|:.:|   |  ||....|.|||...:.:.||:
  Fly   217 AEPCSGDIGSPLL-----SGK---VVVGIVAY---PIGCGCTNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 58/254 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/254 (23%)
Tryp_SPc 43..263 CDD:214473 56/251 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.