DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG30283

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:79/269 - (29%)
Similarity:124/269 - (46%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198
            :|.||.|..:...|||.::..:.      .|:|||.|:.:|:|||:.||:|:.||        .|
  Fly    42 KILGGHNAPVASAPWMAMVMGEG------GFHCGGTLITNRFVLTSAHCIANGEL--------KV 92

  Fly   199 RLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNS--VDQRNDIALVRLKRIVSY 261
            |||..:.                     :.|.:|..:..|:....  .|| :|:||:||.:.|.|
  Fly    93 RLGVLER---------------------EAEAQKFAVDAMFVHTDYYFDQ-HDLALLRLAKRVHY 135

  Fly   262 TDYVRPICLPTDGLVQN------NFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYS 320
            :|.:.||||..|.||:|      .|..|     |||.||:...|.:..|.::...:.:.|.::|.
  Fly   136 SDNISPICLLLDPLVKNIDEHIVKFRTY-----GWGKTESRSSSRMLQKTSLFNLHRSECAKQYP 195

  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385
              ..:::.:.:|| .....:||.|||||||...::.....:.:..||||:|...|..   ..|:|
  Fly   196 --HQQINRNHICA-ESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSK---ATVFT 254

  Fly   386 RTGAFIDWI 394
            .....:|||
  Fly   255 NVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 79/268 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 77/267 (29%)
Tryp_SPc 43..266 CDD:238113 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.