DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Jon44E

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:318 Identity:82/318 - (25%)
Similarity:130/318 - (40%) Gaps:73/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LVCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYK 155
            |.|...:..|.:    |:.|.| |:...|:.....:.|     ||..|......:.|::|.|   
  Fly     7 LACLAVASAGVV----PSESAR-AVPVKDMPRAGKIEG-----RITNGYPAYEGKIPYIVGL--- 58

  Fly   156 KLFSETYTFN-----CGGALLNSRYVLTAGHCL--ASRELDKSGAVL-HSVRLGEWDTRTD---- 208
                   :||     |||::::..:||||.||.  |:..|...||.. |..:...|.:|:|    
  Fly    59 -------SFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQH 116

  Fly   209 PDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTD 273
            ||....:|                               |||||:|:.. |.:...|..:.||:.
  Fly   117 PDWNDFLN-------------------------------NDIALIRIPH-VDFWSLVNKVELPSY 149

  Fly   274 GLVQNNFVDYGMDVAGWGLTENMQPSAIKLK-ITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQL 337
            ....|::..:....:|||||:|....:..|. :.|.:.:...|:..|.|..:  .|:.:|.....
  Fly   150 NDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYI--TDNTICINTDG 212

  Fly   338 GVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395
            |..:|.|||||||::      .|...|.|:.|:|:......|.|..:||...::|||:
  Fly   213 GKSSCSGDSGGPLVL------HDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 1/2 (50%)
Tryp_SPc 135..397 CDD:238113 72/274 (26%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/272 (26%)
Tryp_SPc 41..266 CDD:238113 72/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.