DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and try-9

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:269 Identity:59/269 - (21%)
Similarity:95/269 - (35%) Gaps:88/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 FSETYTFNCG-GALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTD--PDCTTQMNGQR 219
            |||......| |.|::..:::||.|.:...|                    |  |||.|....:.
 Worm    19 FSENEFVQHGTGTLVSPWHIVTAAHLIGISE--------------------DPLPDCDTGNLREA 63

  Fly   220 ---------------ICAPKHIDIEVEKGIIH--EMYAPNSV-----------------DQRNDI 250
                           .||..    |:.|| :|  :|:.|.::                 :..|||
 Worm    64 YFVRDYKNFVAFVNVTCAVP----EMCKG-LHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDI 123

  Fly   251 ALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPS-----AIKLKITVNVW 310
            |:..|:..:.::..:.|.|||:...:. ...:.|..:.|:|    ..||     :.|||...:. 
 Worm   124 AVFELEEPIEFSKDIFPACLPSAPKIP-RIRETGYKLFGYG----RDPSDSVLESGKLKSLYSF- 182

  Fly   311 NLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPC 375
             :..|.:.:....|      .|........:|.||||..::....|  |:|..:.||.|.| .||
 Worm   183 -VAECSDDFPYGGV------YCTSAVNRGLSCDGDSGSGVVRTSDT--RNVQVLVGVLSAG-MPC 237

  Fly   376 GLKGWPGVY 384
                 |.:|
 Worm   238 -----PELY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 59/269 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 51/247 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.