DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG4650

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:289 Identity:70/289 - (24%)
Similarity:119/289 - (41%) Gaps:62/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LPGNDV-----CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAG 180
            :||:..     ||.|...:|....::     |||..|...:|.     :.|||.::..:.||||.
  Fly    17 VPGSSQYLDGRCGLLTNGKIANNISS-----PWMAYLHTSELL-----YVCGGTVITEKLVLTAA 71

  Fly   181 HCL-ASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSV 244
            ||. ||.:|        ..|:||: ..||....|.::          :.:|.:..||.:|  |:.
  Fly    72 HCTRASEQL--------VARIGEF-IGTDDANDTMLS----------EYQVSQTFIHSLY--NTT 115

  Fly   245 DQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAG--WGLTENMQPSAIKLKITV 307
            ...||||::.|...:.::..:||||: ....:...::|....::|  |||..:...|        
  Fly   116 TSANDIAILGLATDIVFSKTIRPICI-VWWTIWRKYIDNIQVLSGAQWGLPNDRNES-------- 171

  Fly   308 NVWNLTSCQEKYSSFKVKLD-----DSQMCAGGQLGVDT--CGGDSGGPLMVPISTGGRDVFYIA 365
            :.:.:|..:.:.::....|:     .||.|||..   |:  |..|...||...|:......:.:.
  Fly   172 DAFRITDIRRQPANMCSTLNGTAILSSQFCAGDS---DSKLCNVDFSSPLGAIITFKNIQRYVLI 233

  Fly   366 GVTSYGTKPCGLKGWPGVYTRTGAFIDWI 394
            |:.:...| |..   ..|||...:..|:|
  Fly   234 GIATTNQK-CKR---ASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/270 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 64/271 (24%)
Tryp_SPc 33..258 CDD:304450 64/271 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.