DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and Sp212

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:124/297 - (41%) Gaps:37/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PTPSTRDALQQ-GDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGAL 170
            |.|...|...| ..|:.|.:.....|   |..|......::||:..:.:|::  ....|.|.|:|
  Fly   251 PPPQRFDPRSQISSVVCGREGSTTPF---IVRGNEFPRGQYPWLSAVYHKEV--RALAFKCRGSL 310

  Fly   171 LNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGII 235
            ::|..|::|.||:.....|:.     .|.||.:|.....:...:|.            .|.:.:.
  Fly   311 ISSSIVISAAHCVHRMTEDRV-----VVGLGRYDLDDYGEDGAEMR------------NVMRLLW 358

  Fly   236 HEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSA 300
            |..|...|.... ||||:.::|.|::.|.:.|||:.|  :..:..|.....:||||..|:...:.
  Fly   359 HPDYNTRSYSDA-DIALITIERPVTFNDIIAPICMWT--VEASRTVSTTGFIAGWGRDEDSSRTQ 420

  Fly   301 IKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIA 365
            ....:...:.:.|.|...:....|  .:..:|||.:.|...|.|||||.|||  ..|.|  :.:.
  Fly   421 YPRVVEAEIASPTVCASTWRGTMV--TERSLCAGNRDGSGPCVGDSGGGLMV--KQGDR--WLLR 479

  Fly   366 GVTSYGTK----PCGLKGWPGVYTRTGAFIDWIKQKL 398
            |:.|.|.:    .|.|..:. :|......|:||.:.:
  Fly   480 GIVSAGERGPAGTCQLNQYV-LYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 68/265 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 68/265 (26%)
Tryp_SPc 277..511 CDD:214473 66/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.