DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG30187

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:284 Identity:89/284 - (31%)
Similarity:131/284 - (46%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASREL 188
            :.:||...|.:|.||.|.......||..:.     :.|: |.|||.|::.|:||||.||:..:: 
  Fly    25 DQICGINIALKITGGHNAAFQNSVWMAAVH-----NRTH-FICGGTLIHKRFVLTAAHCIVDQD- 82

  Fly   189 DKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQR----ND 249
                  :.||.||.:: ::||            |.:.   :|...::|     :|.|.|    ||
  Fly    83 ------VQSVSLGAYN-KSDP------------ADRK---DVITAVVH-----SSFDVRASYEND 120

  Fly   250 IALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA-GWGLTENMQPSAIKLKITVNVWNLT 313
            |.|::|...|.:...:||||:..:..:.|:..:.....| |||.....:.|.|...|.:|..:..
  Fly   121 IGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDRE 185

  Fly   314 SCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPI---STGGRDVFYIAGVTSYGTKPC 375
            .|   |....|...:.|:|||...| |||||||||||...:   ..|.|:|.:  |:.|.|...|
  Fly   186 EC---YMELSVYPSEKQICAGVPSG-DTCGGDSGGPLTNDVFIQGIGNREVQF--GIISVGKTSC 244

  Fly   376 GLKGWPGVYTRTGAFIDWIKQKLE 399
               ...||||...:|.||||..:|
  Fly   245 ---DGQGVYTDLMSFADWIKMTIE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 85/269 (32%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 82/267 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.