DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG30090

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:298 Identity:95/298 - (31%)
Similarity:141/298 - (47%) Gaps:59/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ALQQGDVLPGNDVCGF---LFADRIFGGTNTTLWEFPWMVLLQYK-KLFSETYTFNCGGALLNSR 174
            :|..|:.|...  ||.   ..|.:|.||.:..:...|||..:... ||.       |||.|:..|
  Fly    18 SLGNGEYLEPR--CGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLI-------CGGTLITQR 73

  Fly   175 YVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMY 239
            :||||.||     :::..||  .|||||:|.....||.:     :||.|:..:.:|:....|..:
  Fly    74 FVLTAAHC-----VNEGSAV--KVRLGEYDDTATEDCNS-----KICIPRAEEHDVDMAFRHGKF 126

  Fly   240 APNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVD--YGMDVAGWGLTENMQPSAIK 302
              :.:...|||||:||.:.|::..::.|||:.. |..:...||  ......|||.|...:...: 
  Fly   127 --SEIKNLNDIALLRLAKFVTFKAHISPICIIL-GTSKRELVDSIEWFVATGWGETRTHRTRGV- 187

  Fly   303 LKIT-VNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPL---------MVPISTG 357
            |:|| :..:|.:.|.:.....   :..:|:|| |:||.|||.|||||||         |.|:.  
  Fly   188 LQITQLQRYNSSQCMQALGRL---VQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQ-- 246

  Fly   358 GRDVFYIAGVTSYGTKPC-GLKGWPGVYTRTGAFIDWI 394
                   .||.|||::.| |:    ||||...::.|||
  Fly   247 -------FGVVSYGSRECSGI----GVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 89/274 (32%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 87/273 (32%)
Tryp_SPc 40..276 CDD:238113 89/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463639
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.