DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG30083

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:269 Identity:90/269 - (33%)
Similarity:130/269 - (48%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CGFL-FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDK 190
            ||:. .:.:|..|.|......|||..: :|....|.....|||.|::.::||:|.||:      |
  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHCI------K 82

  Fly   191 SGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRL 255
            ...:| :|||||            .:..|..|       |.|...::.:...|..  |||.::|:
  Fly    83 RDQIL-AVRLGE------------HSSSRYFA-------VTKAFRNKYFTTGSYS--NDIGILRI 125

  Fly   256 KRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYS 320
            :.||.:...:||||:.||.....|...:  ..||||.|||...|.:...:.:|..|.:.|   |:
  Fly   126 QPIVKFNAVIRPICIITDPTKVPNVKTF--KAAGWGKTENETFSKVLKTVELNELNASEC---YN 185

  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385
            ...|.:.:||:|||...| |||.|||||||:.|:...|...:...|:.|:|:..|..   |||||
  Fly   186 MLWVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS---PGVYT 246

  Fly   386 RTGAFIDWI 394
            |..:|||||
  Fly   247 RLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 88/260 (34%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 86/259 (33%)
Tryp_SPc 34..255 CDD:238113 86/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463551
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.