DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and F10

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:307 Identity:93/307 - (30%)
Similarity:144/307 - (46%) Gaps:57/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DSEPTPSTRDAL-------QQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSET 161
            |.:||.:..|.|       ::||    |::      .||.||......|.||..||    :..|.
Human   207 DLDPTENPFDLLDFNQTQPERGD----NNL------TRIVGGQECKDGECPWQALL----INEEN 257

  Fly   162 YTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHI 226
            ..| |||.:|:..|:|||.|||...:..|       ||:|:.:|..:.      .|:.:    | 
Human   258 EGF-CGGTILSEFYILTAAHCLYQAKRFK-------VRVGDRNTEQEE------GGEAV----H- 303

  Fly   227 DIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDY--GMDVAG 289
              |||..|.|..:...:.|  .|||::|||..:::...|.|.|||.....::..:..  |: |:|
Human   304 --EVEVVIKHNRFTKETYD--FDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGI-VSG 363

  Fly   290 WGLTENMQPSAIKLK-ITVNVWNLTSCQEKYSSFKVKLDDSQMCAG-GQLGVDTCGGDSGGPLMV 352
            :|.|......:.:|| :.|...:..||  |.||..: :..:..||| .....|.|.||||||.: 
Human   364 FGRTHEKGRQSTRLKMLEVPYVDRNSC--KLSSSFI-ITQNMFCAGYDTKQEDACQGDSGGPHV- 424

  Fly   353 PISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKLE 399
               |..:|.:::.|:.|:| :.|..||..|:||:..||:.||.:.::
Human   425 ---TRFKDTYFVTGIVSWG-EGCARKGKYGIYTKVTAFLKWIDRSMK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 84/265 (32%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 84/264 (32%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.