DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and try-5

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:289 Identity:69/289 - (23%)
Similarity:115/289 - (39%) Gaps:60/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NDVCG-------FLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGH 181
            :::||       |:..|.. |.|.......||.|.::.|....: :...|||.|:..::||||.|
 Worm    26 DELCGRQSTYTSFMLTDAA-GNTGNPTHLAPWAVQIRVKARKGD-FEVICGGTLITLKHVLTAAH 88

  Fly   182 CL---------ASRELDKSGAVLHS--------------VRLGEWDTRTDP--DCTTQ-MNGQRI 220
            |.         ...|...||....|              |.:|...||.:.  .|..: .||:  
 Worm    89 CFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGK-- 151

  Fly   221 CAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGM 285
                  .:::.:..|.:.|..: .:|.|||.::.|:..:...:.....|||.  |.:.| :..|.
 Worm   152 ------TLKISRFAIGDFYKTH-CEQGNDIVILELESTIDDVEGANYACLPF--LPEVN-IQSGA 206

  Fly   286 DVA--GWGLT-----ENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCG 343
            :|.  |||..     :|.....|:: :|:....|.:|:|.:.: .:..|  ..|...:...:.|.
 Worm   207 NVTSFGWGSDPGKGFDNAAFPMIQV-LTLATETLATCEENWGT-SIPFD--SFCTAEEEDKNVCS 267

  Fly   344 GDSGGPLMVPISTGGRDVFYIAGVTSYGT 372
            |||||.|....|...|:  :|..:.|||:
 Worm   268 GDSGGGLTFHQSDSARE--FIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/271 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 63/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.