DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and try-3

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:300 Identity:84/300 - (28%)
Similarity:125/300 - (41%) Gaps:87/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFN-----CGGALLNSRYVLTAGHCLASRELD 189
            :|:.||.|| |:......||.     ||.|  |..|     ||..:::..:::||.||..     
 Worm    33 IFSFRIIGG-NSIDDGANWMA-----KLVS--YGDNGQGILCGATVIDDFWLVTAAHCAL----- 84

  Fly   190 KSGAVLHSVRLGEWDTRT-----DPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRND 249
                        :..||:     :|    :.|.:|       ...|::..||..|...:.|  ||
 Worm    85 ------------QLQTRSFVYVREP----KNNRER-------SFSVKEAYIHSGYNNQTAD--ND 124

  Fly   250 IALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLT--------------ENMQPSA 300
            |||:|:...:|... ::|:||..|..........|: |.|:|||              :.:|.::
 Worm   125 IALLRISSDLSKLG-IKPVCLVHDDSKLLKQYKNGV-VIGYGLTLGEDSSGEPKLINSQTLQSTS 187

  Fly   301 IKL---KITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVF 362
            :.:   ...|..|...|.      ..||:...|:|||..|. .|..|||||||::..|.|.    
 Worm   188 VPIISDDDCVKTWRFLSL------LSVKITGYQICAGAYLH-GTAPGDSGGPLLIHKSNGE---- 241

  Fly   363 YI-AGVTSYGTKPCGLKG------WPGVYTRTGAFIDWIK 395
            |: .|:||||..  ||.|      :||||||...::.||:
 Worm   242 YVQIGITSYGAD--GLDGVIDQGKFPGVYTRISKYVPWIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 82/294 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 81/293 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.