DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and try-10

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:225 Identity:55/225 - (24%)
Similarity:84/225 - (37%) Gaps:76/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 FSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICA 222
            |.:..|..|||.|:....|:|:.||:.|.:   ..||...|.||:          ..:|      
 Worm    96 FPDGTTNVCGGVLIAPSIVITSAHCVFSGD---DFAVTAKVTLGD----------VHLN------ 141

  Fly   223 PKHIDIEVE----KGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPIC----------LPTD 273
             ||.|.|.|    ...|.:.:..::.:..:|:|::.|.:...       :|          ||:.
 Worm   142 -KHDDGEQEFRSHAMAISKKFFNDASEANDDVAVIFLPQRAD-------VCHSPLSLQIAKLPST 198

  Fly   274 GLVQNNF--------------VDYGMDVAGWGLTEN----MQPSAIKLKITVNVWNLTSCQEKYS 320
            |.|  ||              |.|   |||||.|||    ...|..::.:.::|..:.  :.||.
 Worm   199 GSV--NFKETAPLTQLQLETSVCY---VAGWGKTENKTAKYSDSVRQMMVNLSVRRIG--KRKYL 256

  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPL 350
            ..|.....|:.|.          ||||.|:
 Worm   257 IAKAVTGSSRACM----------GDSGSPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 55/225 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 55/225 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.