DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG43742

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:237 Identity:86/237 - (36%)
Similarity:118/237 - (49%) Gaps:45/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 FNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDI 228
            |.|||:|::.:|||||.||:  |:||:.     :|.||| :.|:.|          |...||:..
  Fly    56 FFCGGSLIHKQYVLTAAHCV--RDLDEV-----TVHLGE-NNRSCP----------IPVCKHVLR 102

  Fly   229 EVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLV----QNNFVDYGMDVAG 289
            ...|.|:|..:..|..  .|||||:||:|.|.:..::||||:..|..|    ||||..|     |
  Fly   103 LNAKVILHPNFHGNIF--LNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAY-----G 160

  Fly   290 WGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPI 354
            ||.||:...|.:...|.:.....:.|.:..::         :|||...| |||..||||||:...
  Fly   161 WGKTEHGNISDVLSFIDLVRLPKSMCYQNINT---------ICAGSTSG-DTCESDSGGPLIGNF 215

  Fly   355 STGG--RDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWI 394
            ...|  ||:.:  |:||||...|  .|..||||...|:..||
  Fly   216 VHRGKSRDILF--GITSYGDAEC--SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 86/237 (36%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 84/235 (36%)
Tryp_SPc 35..256 CDD:238113 86/237 (36%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463584
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.