DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and CG43336

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:271 Identity:92/271 - (33%)
Similarity:132/271 - (48%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSV 198
            |:..||..:|...|||..|.     |....|.|||:|:.:|.||||.||.    ||::..|   .
  Fly    37 RVKNGTVASLTSSPWMAFLH-----STDGRFICGGSLITNRLVLTAAHCF----LDRTELV---A 89

  Fly   199 RLGEWDTRT-----DPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRI 258
            ||||:|...     |..||.:           |:..||:|..|..|  |.:....|||::||.|.
  Fly    90 RLGEYDREEYEMCHDSYCTYR-----------IEAMVERGFRHRHY--NPMTMAYDIAILRLYRK 141

  Fly   259 VSYTDYVRPICLPTDGLVQNNFVDYGMDV---AGWGLTENMQPSAIKLKITVNV--WNLTSCQEK 318
            |.|||.:||||:..|.. ...::| .:|.   .|||.||:...|| ||: ||::  .:...|: :
  Fly   142 VQYTDNIRPICIVIDPR-WRKYID-SLDPLTGTGWGKTESEGDSA-KLR-TVDLARKHPEVCR-R 201

  Fly   319 YSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGV 383
            |::  :.|..:|.|||.:.. :.|.||||||:...|..|....|...|:.|:....|.:   ..|
  Fly   202 YAT--LSLTANQFCAGNERS-NLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVM---VSV 260

  Fly   384 YTRTGAFIDWI 394
            :|...:::|||
  Fly   261 FTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 91/270 (34%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 90/269 (33%)
Tryp_SPc 40..271 CDD:238113 89/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463694
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.