DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPE and LOC100004411

DIOPT Version :9

Sequence 1:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:404 Identity:119/404 - (29%)
Similarity:179/404 - (44%) Gaps:81/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SCTPQQSD---ERGQCVHITS--------CPYLANLLMVEPK---TPAQRILLSKSQCGLDNRVE 84
            :|..:.||   :.|.|:|..|        |.......:.|.:   :||.:....|...|      
Zfish   120 NCETEVSDCKYKNGGCLHYCSQNETAGVECSCADGYQLDEDRHSCSPAVQYPCGKQWTG------ 178

  Fly    85 GLVNRIL--VCCPQSMRGNIMDSEPTPS-----TRDALQQG-----------DVL--PGNDVCGF 129
            |:::|.|  |....:...|...|..:||     .|.||:..           |.|  .|:|..|.
Zfish   179 GIMSRSLDDVSHTHADYANHTHSSTSPSHPLHHNRSALENSTHQNQTELTAPDQLLDTGSDFTGG 243

  Fly   130 LFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAV 194
            ....||.||........||.|||:.:    :.|.| |||:|:|.|:|:||.|||....       
Zfish   244 NEDTRIVGGQLQRQGGSPWQVLLRRE----DEYGF-CGGSLINQRWVITAAHCLQQTP------- 296

  Fly   195 LHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIV 259
             |.:.:|::| :..||...|            .|.|||.|.|..|...:.|  :||||:.|...|
Zfish   297 -HHITIGDYD-KMRPDKDEQ------------KITVEKIIPHPHYHEYTFD--SDIALLYLSSAV 345

  Fly   260 SYTDYVRPICLPTDGLVQNNFV--DYGMDVAGWGLTENMQPSAIKL-KITVNVWNLTSCQEKYSS 321
            :...:..|.|||...|.:....  :.|: |:|||.|..:|.|:..| |:.:.|....||   .:|
Zfish   346 TLGPFASPACLPDANLAERLMKPGEQGL-VSGWGSTHYLQRSSRFLRKVQLPVVEQKSC---INS 406

  Fly   322 FKVKLDDSQMCAGGQL-GVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385
            .:..:.|:..|||..: .:|.|.||||||.:|    ..|..:::.||.|:|.: |..:|..||||
Zfish   407 TEQIITDNMFCAGFLMEEMDACTGDSGGPFIV----NYRGTWFLTGVVSWGER-CASQGKYGVYT 466

  Fly   386 RTGAFIDWIKQKLE 399
            |.|.::.||:::::
Zfish   467 RLGNYLSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPENP_651168.1 CLIP 42..94 CDD:314844 14/64 (22%)
Tryp_SPc 135..397 CDD:238113 89/265 (34%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011 0/1 (0%)
FXa_inhibition 128..164 CDD:291342 6/35 (17%)
Tryp_SPc 248..475 CDD:214473 88/263 (33%)
Tryp_SPc 249..477 CDD:238113 89/264 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.