DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16710 and CG11841

DIOPT Version :10

Sequence 1:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:270 Identity:87/270 - (32%)
Similarity:124/270 - (45%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRL 170
            |..|...:|.|.|:.|.:  .||..   |..:...|.|:||:||.|||||||......::..|||
  Fly    72 IVDGTPAEPKEFPFAARL--GHRKT---NNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131

  Fly   171 GEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIK-HRHYMVFEERP--YNDIALLRLKFPVRYT 232
            ||....::.|         ...||...:   |::| |..:    |.|  ||||.:::|...|::.
  Fly   132 GELEFDTDTD---------DAEPEDFGV---LALKAHPGF----ENPQLYNDIGIVQLDREVKFN 180

  Fly   233 AQIKPICVQLDYIFSNPSFSNHKLQIA-GWG-LSHKQGYSNVLLQAYVNGRNADECSLS-----E 290
            ....|.|:..|      ....|:..|| ||| ....|..|..||:..:.|.. |.|..|     |
  Fly   181 RYKHPACLPFD------DGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYK-DRCVSSVDANDE 238

  Fly   291 PSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVY-LAGITSYGYSQCGYG--PAAY 352
            ...|.:.::.:|.|:....|||.||||||::|..:  |...:| :.||||.|.: |...  |:||
  Fly   239 LPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHK--DLACMYHVMGITSAGIT-CSTPDIPSAY 300

  Fly   353 TKTSKFVEWI 362
            |:...|:.||
  Fly   301 TRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16710NP_651167.3 CLIP 36..84 CDD:463440
Tryp_SPc 105..362 CDD:214473 85/268 (32%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 87/270 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.