DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16710 and CG18420

DIOPT Version :9

Sequence 1:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:284 Identity:92/284 - (32%)
Similarity:131/284 - (46%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ILPNTQI----CG---PIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLIT 147
            :|.:||.    ||   |:....||..|:....|..||||   :.|.|.   |:.:   |.|:||:
  Fly    20 LLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMA---FLHTSS---NQFI---CGGTLIS 75

  Fly   148 NRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHING-REHCAPEHLEIDVDLSIKHRHYMV 211
            .|.|||||||. |....: .|||||:|        ..:.| ||    ||   .|:.:.:||.|  
  Fly    76 RRLVLTAAHCF-IPNTTI-VVRLGEYN--------RKLKGYRE----EH---QVNRTFQHRFY-- 121

  Fly   212 FEERPY-NDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQ 275
             :...: ||||||||...|.|.|.|:|||:..|..:.:...|...|...|||.:.....|:.|..
  Fly   122 -DPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRT 185

  Fly   276 AYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIME-RGDEEFVYLA-GIT 338
            ..::.:.:..|     :.|.......||||...| .|.||:|||:.|::. |....||.:. .||
  Fly   186 LDISRQPSKMC-----AFGSVLSNQFCAGNWNSN-LCIGDTGGPVGAMVRYRNAFRFVQVGIAIT 244

  Fly   339 SYGYSQCGYGPAAYTKTSKFVEWI 362
            :   .:| ..|:.:|.....:|:|
  Fly   245 N---KRC-QRPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 85/260 (33%)
Tryp_SPc 106..362 CDD:238113 84/259 (32%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 85/260 (33%)
Tryp_SPc 43..267 CDD:238113 85/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.