DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and GILT

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001154228.1 Gene:GILT / 826908 AraportID:AT4G12960 Length:243 Species:Arabidopsis thaliana


Alignment Length:215 Identity:69/215 - (32%)
Similarity:90/215 - (41%) Gaps:39/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.||||    :.....|...::.::.:.||||:|||.|.||:...|. .:...|....|||.|.|
plant    12 FGCLLL----LTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLG-KIFDYDLYTITDLKLFP 71

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILE-----------HHDIAQSLKLIACMMRGKKNRL 124
            :|||..:|:..|.||||..||:|||..||.|.           :.........|.|:....|. .
plant    72 FGNAELSDNLTVTCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQKSQYSFIRCVESDTKG-W 135

  Fly   125 EKCADHYQIDVGDVKNCKKTRQVN-----DILRK----YGKET--AKVSFQGVPAVALDNVYNAD 178
            |.|          |||..:.:.:|     |:.||    |..:|  .|...:.||.|.| |....|
plant   136 ESC----------VKNSGREKAINDCYNGDLSRKLILGYATKTKNLKPPHEYVPWVTL-NGKPLD 189

  Fly   179 LSANLTDHFDAIFCAKYKEK 198
            .|...||...|..|..||.|
plant   190 DSVQSTDDLVAQICNAYKGK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 39/108 (36%)
GILTNP_001154228.1 GILT 33..141 CDD:281251 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.